SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011668050.1.67380 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011668050.1.67380
Domain Number 1 Region: 1-305
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.06e-84
Family RNase Z-like 0.0000000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011668050.1.67380
Sequence length 317
Comment ribonuclease Z [Lactobacillus brevis]; AA=GCF_002117375.1; RF=na; TAX=1580; STAX=1580; NAME=Lactobacillus brevis; strain=TMW 1.2111; AL=Complete Genome; RT=Major
Sequence
MEIEFLGTGAGSPGKFRNVTSTALRLLDERNSVWLFDVGEATQHQILRTTLKPRKIDKIF
ITHLHGDHIFGLPGLLSSRSFQGGDAPLTIYGPKGIRNFVEVSLRVSETKLSYKIRYQEL
TTDGLVFEDGKFRVYAQHLDHRIECFGYRIEEKDHPGELQVEQLQAAKIPSGPVYGQLKA
GKTVTLPDGRVINGADFLGPAQPGRIVAILGDTRQTPNAEKLAINADVLVHESTFAKGES
KLARSYYHSTNIQAAELAKRMHVKQLLLNHISARYTGKMAAELQHQAREVFKQTRVVKDF
DEIEVPFEKLTKEGTPS
Download sequence
Identical sequences A0A0A7U155 A0A0C1PPI4 M5ADV1 Q03QP5 U2NW07
gi|116333981|ref|YP_795508.1| gi|472407059|ref|YP_007654164.1| WP_011668050.1.1001 WP_011668050.1.10245 WP_011668050.1.12110 WP_011668050.1.12992 WP_011668050.1.14555 WP_011668050.1.30569 WP_011668050.1.33510 WP_011668050.1.34389 WP_011668050.1.35134 WP_011668050.1.35844 WP_011668050.1.41999 WP_011668050.1.49372 WP_011668050.1.51823 WP_011668050.1.56537 WP_011668050.1.57633 WP_011668050.1.61846 WP_011668050.1.6335 WP_011668050.1.67033 WP_011668050.1.67380 WP_011668050.1.68109 WP_011668050.1.79023 WP_011668050.1.80197 WP_011668050.1.85477 WP_011668050.1.86233 WP_011668050.1.86414 WP_011668050.1.92695 387344.LVIS_1379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]