SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011671365.1.75262 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011671365.1.75262
Domain Number - Region: 4-70
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00053
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 
Domain Number - Region: 104-139
Classification Level Classification E-value
Superfamily RING/U-box 0.00544
Family RING finger domain, C3HC4 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011671365.1.75262
Sequence length 151
Comment hypothetical protein [Leptospira borgpetersenii]; AA=GCF_000355135.1; RF=na; TAX=1303729; STAX=174; NAME=Leptospira borgpetersenii serovar Hardjo-bovis str. Sponselee; strain=Sponselee; AL=Contig; RT=Major
Sequence
MKEIIINLQGDLDFKLGEALLSKLEELSEFPRKILLDASGLKSTTPEGVSLLNRLPKRFP
ESKFAICSVPIEISAQNEKEIPVFKDRESAKSHLIATDSSAFSENTPTLINCPICFHLLK
IQNFGNHSCPLCHAKFFVTKDLRASAFERLL
Download sequence
Identical sequences M6BP22 Q04NF8
355276.LBL_4190 355277.LBJ_4175 WP_011671365.1.14 WP_011671365.1.30409 WP_011671365.1.38848 WP_011671365.1.421 WP_011671365.1.48790 WP_011671365.1.51494 WP_011671365.1.51921 WP_011671365.1.55252 WP_011671365.1.75198 WP_011671365.1.75262 WP_011671365.1.76100 WP_011671365.1.87468 WP_011671365.1.95176 gi|116332603|ref|YP_802320.1| gi|116329719|ref|YP_799438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]