SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011680578.1.77140 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011680578.1.77140
Domain Number 1 Region: 7-220
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.64e-52
Family PP-loop ATPase 0.00059
Further Details:      
 
Domain Number 2 Region: 340-392
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000915
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011680578.1.77140
Sequence length 421
Comment tRNA(Ile)-lysidine synthetase [Streptococcus thermophilus]; AA=GCF_000014485.1; RF=na; TAX=322159; STAX=1308; NAME=Streptococcus thermophilus LMD-9; strain=LMD-9; AL=Complete Genome; RT=Major
Sequence
MTEKLLQMMQEKGYFNQHKKVLVAVSGGADSMSLLHFLYNHQKDLDIQLGIAHVNHKQRQ
ESEYEENYLRHWAKEHKVPFHYSAFSGKFSENAARTFRYDFFKRIMKEADYSALVTAHHA
DDQAETIFMRLLRGSRLRHLSGICDVRSFGTGQIIRPFLHIPKDQLPVTFHFEDRSNSSL
AYLRNRIRLTYLPTLSQENPKFKEHLCLLADEIALMEKALEELTKDITITDLSVFQQQTN
AVQHLLIQSYLESFPDLQLSKGQFNQLMSFLRKKTSGKMPLKNGYVLVKTQTDFLITKEE
PISLSSPSLLEFGKSIVFEEYLLTFSEPHVVSNVDTINIWSDAPIVIRHRHEGDRIDLGT
HHKKIRRLFIDNKISEKDRQKAIIGEQDGQIIFLYVAGRLYLKKRPKNAILYGTVVIYKK
F
Download sequence
Identical sequences A0A0E2RYB1 A0A0M4H8S9 F8LU91 V8LZB8
gi|386085716|ref|YP_006001590.1| gi|387908819|ref|YP_006339125.1| WP_011680578.1.14497 WP_011680578.1.20570 WP_011680578.1.25847 WP_011680578.1.45745 WP_011680578.1.46579 WP_011680578.1.49400 WP_011680578.1.52035 WP_011680578.1.53867 WP_011680578.1.54201 WP_011680578.1.60701 WP_011680578.1.61748 WP_011680578.1.71797 WP_011680578.1.75065 WP_011680578.1.77140 WP_011680578.1.77415 WP_011680578.1.83814 WP_011680578.1.84427 WP_011680578.1.86693 WP_011680578.1.90490 WP_011680578.1.94133 WP_011680578.1.96332 gi|386343619|ref|YP_006039783.1| 322159.STER_0012 gi|116626984|ref|YP_819603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]