SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011683265.1.46729 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011683265.1.46729
Domain Number 1 Region: 26-189
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.97e-27
Family Clp protease, ClpP subunit 0.011
Further Details:      
 
Domain Number 2 Region: 363-428
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000589
Family NfeD domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011683265.1.46729
Sequence length 429
Comment nodulation protein NfeD [Candidatus Solibacter usitatus]; AA=GCF_000014905.1; RF=na; TAX=234267; STAX=332163; NAME=Candidatus Solibacter usitatus Ellin6076; strain=Ellin6076; AL=Complete Genome; RT=Major
Sequence
MYSEGRLRVRAVFMLALAPAIGAVAAPPRVITVDVDGMVHPITAEIVNGALLQARDQHAS
LVVIRLNTPGGLMDAMRSTIEKILASPVPVVTYVSPSGGRAASAGFFLLEAGDVAAMAPG
TETGAAHPVLIGSEMDPVMKQKVENDAAAYLRSISEKRGRNSALAETAVRESKSFTDREA
LDQKLVDVIEPGDRQLLAALDGRTVTRFDGSSTTLHTAGAEIVAYERTRRQQIIAAIADP
NIALILLVIGALGIYVEFSSPGLVAPGVIGGILVLLGLSAISVLPLNWLGAALMILAFTL
FVLEVKFTSHGILGAGGTVAMVLGAVMLVDSPVPELRIHWSTAIALALPFSAITVFLLTI
AARARRNKVETGVEGMIGQLGTAMTNLTPEGKVFVHGEYWNAIAVRPAEAGARVKVTAID
GLRVTVEPM
Download sequence
Identical sequences Q028R2
234267.Acid_1498 gi|116620619|ref|YP_822775.1| WP_011683265.1.46729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]