SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011683770.1.46729 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011683770.1.46729
Domain Number 1 Region: 35-298
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.28e-72
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011683770.1.46729
Sequence length 303
Comment proline dehydrogenase [Candidatus Solibacter usitatus]; AA=GCF_000014905.1; RF=na; TAX=234267; STAX=332163; NAME=Candidatus Solibacter usitatus Ellin6076; strain=Ellin6076; AL=Complete Genome; RT=Major
Sequence
MVRAFFLFLSRQKQLRRWMETSPVAQRLSKRFVAGETLEQALAVSRKLNKQGITVTLDHL
GESVTSLAEAREARDVYRRTLDAIHAGDIQGNVSLKLTQFGLDLSYEECLANVEQLVRRA
AELGSFVRVDMESSEYVDRTLDLVRTLHARHGAVGVVIQSYLYRSKDDIAKLCAEKIRVR
LCKGAYLEPASLAFPQKSDVDRSYVELTQKLLTYGVYPAIATHDEAMIGQTKQFVSSKGI
GRECFEFQMLYGIRADLQRQLVADGYRLRLYVPFGKAWYPYYMRRLAERPANVLFILRNL
FRT
Download sequence
Identical sequences Q026S2
gi|116621126|ref|YP_823282.1| 234267.Acid_2007 WP_011683770.1.46729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]