SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011719141.1.7777 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011719141.1.7777
Domain Number 1 Region: 6-221
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.47e-61
Family G proteins 0.000000174
Further Details:      
 
Domain Number 2 Region: 305-397
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.74e-38
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000075
Further Details:      
 
Domain Number 3 Region: 207-304
Classification Level Classification E-value
Superfamily Translation proteins 9.03e-33
Family Elongation factors 0.0000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011719141.1.7777
Sequence length 397
Comment elongation factor Tu [Acidothermus cellulolyticus]; AA=GCF_000015025.1; RF=representative genome; TAX=351607; STAX=28049; NAME=Acidothermus cellulolyticus 11B; strain=11B; ATCC 43068; AL=Complete Genome; RT=Major
Sequence
MAKAKFERTKPHVNIGTIGHIDHGKTTLTAAITKVLHDQNPDINPYTPFEQIDKAPEERA
RGITISIAHVEYQTEKRHYAHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTKE
HVLLARQVGVPYIVVALNKADVVDDEEILQLVELEVRELLNSYEFPGDDVPVVRVSALKA
LEGDPKWTQSILDLLKACDDYIPEPVREIDKPFLMPIEDVFTITGRGTVVTGRVERGVVK
VGDEVEIVGIHPKTLKTTVTGVEMFRKLLDEGRAGDNIGVLLRGIKREEVERGQVVCKPG
SITPHTEFEAQVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNT
EMRVELIQPIAMEEGLRFAIREGGRTVGAGRVTKILK
Download sequence
Identical sequences A0LRL8
gi|117927513|ref|YP_872064.1| 351607.Acel_0304 WP_011719141.1.7777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]