SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011740352.1.33562 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011740352.1.33562
Domain Number 1 Region: 16-173
Classification Level Classification E-value
Superfamily PEBP-like 2.75e-48
Family Prokaryotic PEBP-like proteins 0.0000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011740352.1.33562
Sequence length 175
Comment MULTISPECIES: hypothetical protein [Mycobacterium]; AA=GCF_000419295.1; RF=na; TAX=1187065; STAX=1187065; NAME=Mycobacterium sp. 012931; strain=012931; AL=Contig; RT=Major
Sequence
MTSPDPYDALPKLPSFSLTSASITDGQPLATPQVSGIMGAGGEDVSPQLSWSGFPEGTRS
FAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGAGDGRELPGGALALVNDAGMRRYIGA
APPAGHGVHRYYVAVHAVDVDKLELSEDASPAFLGFNLFQHAIARAVIHGTYEQT
Download sequence
Identical sequences A0A1B4Y3T9 A0PQW7 B2HFZ3 L7V9D8
gi|443491443|ref|YP_007369590.1| gi|118617875|ref|YP_906207.1| gi|183983121|ref|YP_001851412.1| WP_011740352.1.20315 WP_011740352.1.28311 WP_011740352.1.33562 WP_011740352.1.39490 WP_011740352.1.48473 WP_011740352.1.5386 WP_011740352.1.90902 WP_011740352.1.91103 WP_011740352.1.92715 216594.MMAR_3122 362242.MUL_2372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]