SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011741090.1.39490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011741090.1.39490
Domain Number 1 Region: 38-140
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000392
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011741090.1.39490
Sequence length 146
Comment MULTISPECIES: hypothetical protein [Mycobacterium]; AA=GCF_001515365.1; RF=na; TAX=1136880; STAX=265949; NAME=Mycobacterium pseudoshottsii L15; strain=JCM 15466; AL=Scaffold; RT=Major
Sequence
MSVDIAEPFTPHPMLSIRLLRELGDPHSTLRAATDFRSTAVLIHAGGEVDAANEHTWRQL
IAETAASAPSPGLFVVDVSGLDFMGCCAFEVLAEQAGRCRARGVELRIASAAHTRVTRIV
AACGLSDALPVYRSVDAALALPAPSD
Download sequence
Identical sequences A0PT12 L7V2T1
362242.MUL_3282 WP_011741090.1.20315 WP_011741090.1.39490 WP_011741090.1.5386 gi|118618620|ref|YP_906952.1| MyulA.17065.a gi|443490471|ref|YP_007368618.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]