SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011742586.1.43097 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011742586.1.43097
Domain Number 1 Region: 89-222
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.17e-17
Family Protein-L-isoaspartyl O-methyltransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011742586.1.43097
Sequence length 424
Comment DNA methyltransferase [Bifidobacterium adolescentis]; AA=GCF_001406215.1; RF=na; TAX=1680; STAX=1680; NAME=Bifidobacterium adolescentis; strain=2789STDY5834850; AL=Contig; RT=Major
Sequence
MSDGPLLNDVTRAFAEAHRNEDVRDLALKTKRTADLDLPAALDQIAGWQIARNKLPQWAA
CADIVYPAHISMEQCSSQFTAQYKAEIARRLLRSLPQSAGQTANDATMTDLTGGFGVDFS
YLARGFGHATYVERQSHLCELAAHNMAALGLTQAQVVCGDGVEYLRAMEPAQLIYIDPAR
RDEHGARTYAIEDCTPDVLALRDLLLAKARYVMIKLSPMLDWRKAVDDFAGTVAEVHIVS
TGNECKELLLVLDGKAAGATSDAAAADTRAPHVYCVNDDQRLDYDAAAYTRGLRIGDAPL
PHELRYLYEPNASIMKAGCFDVVEARFGAVQIGPSSHLFVSDEPVDGFPGRGFAIETIGG
MGKKELKRLLSGLDRANIAVRNFPLTAPQLRKKLKLADGGDAYLFGTTMQGGDHVLIRTA
KISR
Download sequence
Identical sequences A0A174CEZ5 A0ZZD1
APC38931 WP_011742586.1.36503 WP_011742586.1.43097 WP_011742586.1.6218 WP_011742586.1.64668 WP_011742586.1.76728 367928.BAD_0033 gi|119025051|ref|YP_908896.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]