SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011742866.1.36503 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011742866.1.36503
Domain Number 1 Region: 2-64,162-461
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 9.94e-60
Family Glycosyl transferases group 1 0.0062
Further Details:      
 
Weak hits

Sequence:  WP_011742866.1.36503
Domain Number - Region: 76-110
Classification Level Classification E-value
Superfamily Homeodomain-like 0.064
Family Myb/SANT domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011742866.1.36503
Sequence length 472
Comment glycosyl transferase [Bifidobacterium adolescentis]; AA=GCF_000010425.1; RF=representative genome; TAX=367928; STAX=1680; NAME=Bifidobacterium adolescentis ATCC 15703; strain=ATCC 15703; AL=Complete Genome; RT=Major
Sequence
MRICLVLEGCYPYVHGGVSTWMHSYITAMKEHEFVLWVIGAKAKDRGKFVYDLPSNVVEV
HEVFLDDALRLSGEHAKVIFTDEEVKALRELVNLSDPDWDVLFNLFHNKGVHPLSFLQSN
EFIDLFTKICMEEYPYVAYADAFHTVRSMLLPVLYLMTGEVPKAQIYHAISTGYGGLLAC
LGGSINHAPVLLTEHGIYTREREEEILSAEWVAPAFRQRWIRFFAMLSQEIYRRAWRVTS
LFGRARQTQIDMGAPASKCLVIPNGIQYERFCDIPLKPEDGWVDIGAVVRLAPIKDVKTL
IHAFSELSNRVDNVRLHILGGVDDQDYADECYELVKQLEVKNLEFTGRVNVVEYMRKLDF
TVLTSISEGQPLSVLESFAAARPCVTTDVGCCRELLEGEEGDDLGVAGFYVPPMYREGLA
RAMERMCASRKLREAMGQVGRERVKTYYRHERMLDEYRALYLDTADHYGLEH
Download sequence
Identical sequences A0A087DM24 A0A0C2YNQ4 A1A0E4 R5GQW7
gi|119025414|ref|YP_909259.1| 367928.BAD_0396 WP_011742866.1.16084 WP_011742866.1.23347 WP_011742866.1.3372 WP_011742866.1.36503 WP_011742866.1.38945 WP_011742866.1.51786 WP_011742866.1.55963 WP_011742866.1.64668 WP_011742866.1.76728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]