SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011743135.1.16084 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011743135.1.16084
Domain Number 1 Region: 19-124
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.4e-25
Family DNA-binding N-terminal domain of transcription activators 0.003
Further Details:      
 
Domain Number 2 Region: 160-285
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.71e-16
Family Multidrug-binding domain of transcription activator BmrR 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011743135.1.16084
Sequence length 286
Comment MerR family transcriptional regulator [Bifidobacterium adolescentis]; AA=GCF_000771705.1; RF=na; TAX=1437612; STAX=1680; NAME=Bifidobacterium stercoris JCM 15918; strain=JCM 15918; AL=Contig; RT=Major
Sequence
MTASERSGGRDALPGDGRLFRIGKVADMFNVSLGTLRHYERCGLLEPEYIDPRTGYRYYG
AKQFEVLNTIRYLRVLDMPLTQIAEFLHNRDVHVIEDKLVAQKALIERKQHELEMVQRKI
DHRLERLRDAEQSEFDVIRVVRQPACRIVWIRDSPKVDSYLGLEYSIRKLEQHQKDSLVF
LGKVGVGIDKESLEQGGYADYGLVFLLLDDEDEYEGDTVALPETDCVRIRFRGSHGDAPD
RYRELIWYTAEQGLDITGFSREIALIDEGLTSDPAQFVTEICIPVR
Download sequence
Identical sequences A0A076JHV7 A1A1C7
WP_011743135.1.16084 WP_011743135.1.23347 WP_011743135.1.31140 WP_011743135.1.31393 WP_011743135.1.3372 WP_011743135.1.36503 WP_011743135.1.38945 WP_011743135.1.41253 WP_011743135.1.43097 WP_011743135.1.51786 WP_011743135.1.54320 WP_011743135.1.55963 WP_011743135.1.64668 WP_011743135.1.74636 WP_011743135.1.76728 WP_011743135.1.92700 367928.BAD_0729 gi|119025747|ref|YP_909592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]