SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011743154.1.64668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011743154.1.64668
Domain Number 1 Region: 6-57,85-287
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.66e-62
Family tRNA(1-methyladenosine) methyltransferase-like 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011743154.1.64668
Sequence length 351
Comment methyltransferase [Bifidobacterium adolescentis]; AA=GCF_002108135.1; RF=na; TAX=1680; STAX=1680; NAME=Bifidobacterium adolescentis; strain=LMG 10733; AL=Contig; RT=Major
Sequence
MRRGPLAAGEKVQFTDRRSNKITDQLVPGGVTQTSHGIILHDDVIGQTEGSVVVTVSAKR
EAQVNQTHPERDANKPWKGTRAIGGWEFAVMRPRLADYVLSMPRGAQIMYPKDIAQVIQL
GDIRSGMNVLESGAGSGAMSINLLDAVGEGGSLTTIEMRSEFARVAEANATVYFGKRPAW
WDLRTGDFDSVAAGLPEHSFDRIMLDMLDPWNRLEQAYRVIAPGGVLVAYVTTTTQLSRL
AEALREVGCWTEPDMQETLERNWKAQGLAIRPDHQMIGHTGFLMVSRAMAPGFQALRKRD
RATKDTTTDIDSLTPEERAEQLEDLELRDISDRKLRKVLRDLDAQVEAIKE
Download sequence
Identical sequences A1A1F1
gi|119025771|ref|YP_909616.1| WP_011743154.1.36503 WP_011743154.1.64668 367928.BAD_0753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]