SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011743708.1.36503 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011743708.1.36503
Domain Number 1 Region: 7-153
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-25
Family GHMP Kinase, N-terminal domain 0.00062
Further Details:      
 
Domain Number 2 Region: 189-311
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 6.78e-25
Family Homoserine kinase 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011743708.1.36503
Sequence length 334
Comment homoserine kinase [Bifidobacterium adolescentis]; AA=GCF_000010425.1; RF=representative genome; TAX=367928; STAX=1680; NAME=Bifidobacterium adolescentis ATCC 15703; strain=ATCC 15703; AL=Complete Genome; RT=Major
Sequence
MTPVTRKVRVKVPATSANLGSGFDTVGLALDYHDELEFTLSADPVNTAAQVMIEGEGEDT
LPRDETHLVVSTFRRACQTFGLGRVGFILQAHNNIPQARGMGSSAEAIVAGIAAAAAFAQ
DDDLNRDAVFELAAAIEGHPDNVAPAVYGGLTMSWDMETAEGVGSVPIPGGEPMHNGFHT
INYRVADDLTAAVFVPDYELSTEKARQALPTEIPFKDAVHNVSRVSLLPAAMNPAMLASG
SRQNANALLFAATQDRLHQPYRASLMEPSWALIEKMRSHGFASTVSGAGPCVLVLHHGDA
HEELEQIAAEELASGHWRVLHLAVDTKGVQVERA
Download sequence
Identical sequences A0A087DHM3 A0A0C2V999 A1A3B3
WP_011743708.1.16084 WP_011743708.1.24652 WP_011743708.1.31393 WP_011743708.1.36503 WP_011743708.1.38945 WP_011743708.1.41253 WP_011743708.1.51786 WP_011743708.1.64668 WP_011743708.1.81525 WP_011743708.1.90122 WP_011743708.1.92700 gi|119026433|ref|YP_910278.1| 2004011223 367928.BAD_1415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]