SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011749196.1.52749 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011749196.1.52749
Domain Number 1 Region: 77-204
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.26e-20
Family GntR ligand-binding domain-like 0.025
Further Details:      
 
Domain Number 2 Region: 4-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-18
Family GntR-like transcriptional regulators 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011749196.1.52749
Sequence length 221
Comment GntR family transcriptional regulator [Paracoccus denitrificans]; AA=GCF_000203895.1; RF=representative genome; TAX=318586; STAX=266; NAME=Paracoccus denitrificans PD1222; strain=PD1222; AL=Complete Genome; RT=Major
Sequence
MSAGSEETLAVRISRVLADRIVSGEIGPGERLRQDRIAEEFGASHVPVREAFRRLEAQGL
AISEPRRGVRVAAFDLPEVKEVAEMRAALEELALRHAAPHLTPAILNAAEEATKAGDASR
DVRSWEAANRRFHKLILTPCAMPRLLAAIDDLHAASARFLFAAWQSNWETRTDHDHRAIL
AALRKGDVDTACATLARHVRWIGRRPAPSTSGKPDAFAIHG
Download sequence
Identical sequences A1B662
gi|119385647|ref|YP_916702.1| WP_011749196.1.25907 WP_011749196.1.3707 WP_011749196.1.52749 318586.Pden_2922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]