SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011753865.1.100580 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011753865.1.100580
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.53e-28
Family Anti-sigma factor antagonist SpoIIaa 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011753865.1.100580
Sequence length 112
Comment anti-sigma factor antagonist [Nocardioides sp. JS614]; AA=GCF_002165235.1; RF=na; TAX=2003120; STAX=2003120; NAME=Nocardioides sp. XL1; strain=XL1; AL=Scaffold; RT=Major
Sequence
MDLTLTTRDAGGKTIVAVGGEIDVYTAPKLRDKITELVAAGVYDIVVDMEEVEFLDSTGL
GVLVGGLKKVRAHDGSLQLVCTQDRLLKIFRITGLAKVFVIHDSADAALAGS
Download sequence
Identical sequences A1SDM9
gi|119714636|ref|YP_921601.1| 196162.Noca_0371 WP_011753865.1.100580 WP_011753865.1.96005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]