SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011754240.1.100580 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011754240.1.100580
Domain Number 1 Region: 1-376
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.44e-94
Family Phase 1 flagellin 0.00000905
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011754240.1.100580
Sequence length 376
Comment flagellin [Nocardioides sp. JS614]; AA=GCF_002165235.1; RF=na; TAX=2003120; STAX=2003120; NAME=Nocardioides sp. XL1; strain=XL1; AL=Scaffold; RT=Major
Sequence
MSLRINQNIDALNSYRNLSVTQGQMSKSLEKLSSGYRINRAADDAAGLAISEGLRSQVGG
IKVAVRNAQDGVSVVQTAEGALTETHSILQRMRDLSVQAANDSNDVSSRAAIQSENDALV
DELDRIATSTTFNNVSLLDGNYIGKNFQVGYGTGATDSIAVDITSTGTGGAKSTWANGAA
STTAAAATFTHNGVATTTGVLVASTDANNIATQLNADANFKTNYTASVDDKGGLVVTSKD
GLPGAITVSGAGLAGAHVDAAPGANAGFSSTDLGVGALVLDSAANAKAATNAIDTAIKGV
STARAKLGAMQNRFEHTINNLSVTQENLSASESRIRDTDMAAEMMQFTRSQILSQAGTAM
LAQANQAPQGVLQLLR
Download sequence
Identical sequences A1SEQ6
196162.Noca_0766 gi|119715013|ref|YP_921978.1| WP_011754240.1.100580 WP_011754240.1.96005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]