SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011759139.1.25267 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011759139.1.25267
Domain Number 1 Region: 106-282
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.59e-22
Family Clp protease, ClpP subunit 0.058
Further Details:      
 
Domain Number 2 Region: 458-517
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000719
Family NfeD domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011759139.1.25267
Sequence length 529
Comment membrane-bound serine protease [Shewanella amazonensis]; AA=GCF_000015245.1; RF=representative genome; TAX=326297; STAX=60478; NAME=Shewanella amazonensis SB2B; strain=SB2B; AL=Complete Genome; RT=Major
Sequence
MFNRLFNRLFSPEVVRLLASINRLFASKPGLFALLLPLLLGSLNSGVVASPHAAFSSGFI
LSNANIANTTPVSDRDIGSNHSADLAAAVTSHQNTGARGLEGTVAPIWLLEVKGAIGPGV
ADYLVRTLNKAQKQVVPPQLLLLTLDTPGGLVASLRDINQAILTSEIPVACLVYPAGARA
ASAGTYMLYACHLAAMAPATSLGAATPVQLGPPAGGEPKDKEAEQQGASDMERKILNDAV
AYIRTLAQLRGRNAEWGEQAVREAATATASEALALGAIDLIAKDPYALLEAIDGRQFVIN
DTVRVLHTHKALLLDAKPDWRTTFLSTITNPNVAYVLMMLGIYGLLLEFYSPGMGISGVV
GAICLLVAMFALQMLPINYAGAALLILGIGLLVAESLVPSFGILGFGGVVAFVLGSVFLI
DSELDAFRIAWPVILALAMVSLLFFAVLVSLLFKQRHRAVVSGPEAMVGARALVLDGFPG
KGQVLFMGERWQGHSEQALQSGTWVRVESISGLLLELGPLDESKEKQDE
Download sequence
Identical sequences A1S4C4
gi|119774160|ref|YP_926900.1| 326297.Sama_1023 WP_011759139.1.25267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]