SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011761599.1.25267 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011761599.1.25267
Domain Number 1 Region: 5-85
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000235
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011761599.1.25267
Sequence length 93
Comment hypothetical protein [Shewanella amazonensis]; AA=GCF_000015245.1; RF=representative genome; TAX=326297; STAX=60478; NAME=Shewanella amazonensis SB2B; strain=SB2B; AL=Complete Genome; RT=Major
Sequence
MSENTVELGSELTIRNIQPIYSQLADLLHQGRPVTLNAARLIKADTAGLQLLLCLQSHCE
NSSIPLNWKGITTELVAQFKQMGMQLPGITSQA
Download sequence
Identical sequences A1SBD9
WP_011761599.1.25267 gi|119776625|ref|YP_929365.1| 326297.Sama_3493 376492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]