SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011769909.1.40834 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011769909.1.40834
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.86e-24
Family Sfri0576-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011769909.1.40834
Sequence length 124
Comment STAS/SEC14 domain-containing protein [Psychromonas ingrahamii]; AA=GCF_000015285.1; RF=representative genome; TAX=357804; STAX=357794; NAME=Psychromonas ingrahamii 37; strain=37; AL=Complete Genome; RT=Major
Sequence
MINAKLMRNDGILIVEPVDKLEKKDFKQVALLVNPYLEKHAVLNGILIDAESFPGWENFA
GLVSHLRFINQYEKKVKRIAAVTDIGILSILPKIVKHFVSAEVRHFSYKERELALSWLQT
DGAG
Download sequence
Identical sequences A1SV34
WP_011769909.1.40834 357804.Ping_1540 gi|119945268|ref|YP_942948.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]