SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011794539.1.7412 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011794539.1.7412
Domain Number 1 Region: 123-385
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.67e-54
Family D-glucarate dehydratase-like 0.0000000176
Further Details:      
 
Domain Number 2 Region: 1-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.15e-28
Family Enolase N-terminal domain-like 0.000000863
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011794539.1.7412
Sequence length 389
Comment mandelate racemase [Acidovorax citrulli]; AA=GCF_000968215.1; RF=na; TAX=80869; STAX=80869; NAME=Acidovorax citrulli; strain=tw6; AL=Scaffold; RT=Major
Sequence
MRIVNILESTRPIKSDIRNAYIDFSKMTLSLVAVVTDVIRDGQPVIGYGFNSNGRYGQGA
LMRDRFIPRVLEADPASLVDDTGDNLCPHKVWARMMTNEKPGGHGERSVAVGTIDMAVWD
AVAKIANKPLYQLLAERYGNGTPANPRVFVYAAGGYYYPGKGLDGLKQEMESYLARGYSV
VKMKIGGASLADDCERIESVLKILGPGQQLAVDANGRFDLQTAIDYGKALSQYPLFWYEE
AGDPLDYELQAKLGEVYQGPMATGENLFSMQDARNLIRHGGMRPDRDWLQFDCALSYGLV
EYLRTLDMLKDNGWSPSRCIPHGGHQMSLAIAAGLGLGGNESYPDLFQPYGGFPDGVKVE
NGYVTLPALPGIGFEGKSDLIAEMRALAS
Download sequence
Identical sequences A1TM00
WP_011794539.1.2034 WP_011794539.1.45855 WP_011794539.1.56291 WP_011794539.1.7412 WP_011794539.1.74814 397945.Aave_1397 gi|120610084|ref|YP_969762.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]