SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011795146.1.74814 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011795146.1.74814
Domain Number 1 Region: 40-360,387-494
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.74e-129
Family Amylase, catalytic domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 783-1125
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-16
Family APH phosphotransferases 0.055
Further Details:      
 
Domain Number 3 Region: 499-579
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000000096
Family alpha-Amylases, C-terminal beta-sheet domain 0.014
Further Details:      
 
Weak hits

Sequence:  WP_011795146.1.74814
Domain Number - Region: 704-798
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0966
Family D-glucarate dehydratase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011795146.1.74814
Sequence length 1142
Comment alpha-amylase [Acidovorax citrulli]; AA=GCF_000015325.1; RF=na; TAX=397945; STAX=80869; NAME=Acidovorax citrulli AAC00-1; strain=AAC00-1; AL=Complete Genome; RT=Major
Sequence
MNAPLLRQPLPAADAAAGPLPEPGPVVMPETPEIDTQGDPQWYRDAVIYQLNVKAFFDSN
NDGYGDFKGVTAKLDYVKDLGVNTIWLMPFYPSPLRDDGYDISDYENVHPQYGTLADFKE
MLDAAHARGLRVITELVINHTSSEHPWFQRARRAPPGSPERDFYVWSDTDQIYRGTRIIF
TDTETSNWAWDPVAKQYYWHRFFSHQPDLNFDNPLVLEAVFKTMRFWLDMGVDGFRLDAI
PYLVERDGTSNENLPETHAVIKKLRAAIDAEYRNRFLLAEANMWPEDVREYFGDGDECHM
AYHFPLMPRMYMAIAQEDRHPIVEILQQTPDIPEGCQWAIFLRNHDELTLEMVTSKERDY
MYSMYAADMRARINLGIRRRLAPLMENDLDRVKLMNGMLLSMPGSPIIYYGDEIGMGDNV
FVGDRNGVRTPMQWSPDRNGGFSRSDPQRLYLQPIMDAVYGYEALNVEAQSGDHSSLLHW
TRRMLAVRKTSRAFGRGRRTFLKPGNRKILAYVSEHEDDVILTVFNLSRAAQPVELDLSA
YRGRTPIEMLGRVTFPPIGDLPYLLTLHSYGFYWFRLSNEAPMPSWHQEGLDLQERPVLV
LFDGWTSFFRERVMPWRIGMAERMRAQFEDDTLPRFIELQRWYADKGATIAGARILDHTV
WKAGEGCEWMLPLLGVEPAAKPGGAQGAGATYFVPLALAWEEGSEERMRRISPAGVARVR
QQAQVGVMGDAFHDESFCRMVVRAMGEGTELATDQGGRVRFRRTSAFDALAAELDTLPVE
RPGAQSSNTVVALGETLFLKGYRRLREGVNPELEVGRFLTEVARFPHCVPVAGSVEYVAP
DGATMTLALVQSYVANQGDGWEYTLGYLERFLEDTRLAQAAGPVADMHGGYLALAATLGQ
RTAQLHQALARRTGDAAFDPEPVTTQDVAAFGQRARAEAEDTLVLLERRLGELPPAAQTD
AQAVLARRALIMERLAAGGADAPAGTKTRFHGDYHLGQVLVTGNDFVIIDFEGEPGRPFE
ERRAKSSPLRDVAGMLRSFNYARWAALKHMTQSTEEMVRLDEAARHWEHQVRDAFLAAYA
AEGLAADPALISLFELEKALYELRYELGNRVDWAQVPLQGILALIGAAAAPTPTPNLPDT
PA
Download sequence
Identical sequences A1TNR8
397945.Aave_2022 gi|120610702|ref|YP_970380.1| WP_011795146.1.7412 WP_011795146.1.74814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]