SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011795369.1.56291 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011795369.1.56291
Domain Number 1 Region: 30-303
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.95e-74
Family L-arabinose binding protein-like 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011795369.1.56291
Sequence length 322
Comment LacI family transcriptional regulator [Acidovorax citrulli]; AA=GCF_900100305.1; RF=na; TAX=80869; STAX=80869; NAME=Acidovorax citrulli; strain=DSM 17060; AL=Scaffold; RT=Major
Sequence
MTKLTRRTLATALACAPVAALLPAAAWAQKPIVLGFSQVGAESEWRTANTESIKSAARDA
GIELKFSDAQQKQENQIKAIRSFIAQRVDVIAFSPVVESGWEPVLREAKAAKIPVVLTDR
AVNTKDTSLYVTFMGSDFVEEGRKAGRWLVEKMKDAKGDVNIVELQGTVGSAPAIDRKKG
FEEVVKADPKFKIIRSQTGDFTRAKGKEVMEAFLKAEGRKINVLYAHNDDMAIGAIQAIE
EAGLKPGKDITIISIDAVKGAFEAMMAGKLNVTVECSPLLGPQLMAAVKDIKAGKTVPKR
IVTEEGIFPMETAAQEFPKRKY
Download sequence
Identical sequences A1TPE5
WP_011795369.1.2034 WP_011795369.1.45855 WP_011795369.1.56291 WP_011795369.1.7412 WP_011795369.1.74814 gi|120610929|ref|YP_970607.1| 397945.Aave_2255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]