SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011815340.1.27215 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011815340.1.27215
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.06e-39
Family Frataxin-like 0.00000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011815340.1.27215
Sequence length 106
Comment MULTISPECIES: iron donor protein CyaY [Yersinia]; AA=GCF_001086525.1; RF=na; TAX=630; STAX=630; NAME=Yersinia enterocolitica; strain=ERL08708; AL=Scaffold; RT=Major
Sequence
MNDSEFHQLADQLMLCIEETLDGFSGDSDIDYETNGGVMTLTFENGSKIVINRQEPLHQV
WLATKAGGYHFDYREGHWYCSRSGEEFFTKLSEAATAQAGEVVSFS
Download sequence
Identical sequences A0A0T9U5H8 A0A2J9S6F7 A1JI88
gi|123440584|ref|YP_001004578.1| 393305.YE0190 WP_011815340.1.16 WP_011815340.1.22156 WP_011815340.1.25286 WP_011815340.1.27215 WP_011815340.1.27965 WP_011815340.1.34811 WP_011815340.1.35647 WP_011815340.1.37392 WP_011815340.1.47151 WP_011815340.1.51324 WP_011815340.1.64144 WP_011815340.1.67007 WP_011815340.1.84820 WP_011815340.1.85518 WP_011815340.1.86434 WP_011815340.1.91311 WP_011815340.1.94794 WP_011815340.1.95930 YP_001004578.1.77335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]