SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011819773.1.83733 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011819773.1.83733
Domain Number 1 Region: 12-208
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.58e-60
Family "Hypothetical" protein ybl036c 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011819773.1.83733
Sequence length 212
Comment YggS family pyridoxal phosphate enzyme [Prochlorococcus marinus]; AA=GCF_000015665.1; RF=representative genome; TAX=167542; STAX=1219; NAME=Prochlorococcus marinus str. MIT 9515; strain=MIT 9515; AL=Complete Genome; RT=Major
Sequence
MEISNYLQIKKELPLNVNLLAVSKGFGSQDIKIINDKGQNDFGESRFQEAIEKKLLLKDF
KDIKWHFIGRIQSNKIRKIVQNFDYIHSVDSYEKLLKISNIAFEEHKNPLIMLQVKLMDD
PSKGGFNPKDLLGKWDEIKQLKSIKIKGLMTINPKGLNSTQNIKLFKECRNLANSLKLHD
CSMGMSQDWKEAVEAGSTWLRLGSIIFGNRSY
Download sequence
Identical sequences A2BV54
gi|123965691|ref|YP_001010772.1| WP_011819773.1.83733 167542.P9515_04561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]