SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011821840.1.50451 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011821840.1.50451
Domain Number 1 Region: 4-269
Classification Level Classification E-value
Superfamily SIS domain 2.92e-21
Family mono-SIS domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011821840.1.50451
Sequence length 301
Comment hypothetical protein [Hyperthermus butylicus]; AA=GCF_000015145.1; RF=representative genome; TAX=415426; STAX=54248; NAME=Hyperthermus butylicus DSM 5456; strain=DSM 5456; AL=Complete Genome; RT=Major
Sequence
MANLAKYILSELERINAIVSEQLEHTKPLLEGAECIAAIGAGDSYAAALALEACSGGTAE
ALDPFDALYSGRLGRLARKGCILVALSVGGRTRAVLDVAQRYRELGGRVVAVTGPGTPLA
SLANDAVELVYTGLASGIGAARHVAMLAALAGLLGAQPQVANLDAPCELARADAYAGACE
AYSSAHYAELKRAEVWGEAAPSHRLEQLVHAPIYTAKTVAVYESSIASRDRQREALETLR
EAGFQVYTVPATGDCWSTILSQAAATLYCIAVRAENEKVEEPAYRRHPGLEHLTRLIYEM
S
Download sequence
Identical sequences A2BKL1
gi|124027547|ref|YP_001012867.1| 415426.Hbut_0666 WP_011821840.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]