SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011821999.1.50451 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011821999.1.50451
Domain Number 1 Region: 6-288
Classification Level Classification E-value
Superfamily Folate-binding domain 8.16e-74
Family Aminomethyltransferase folate-binding domain 0.00000363
Further Details:      
 
Domain Number 2 Region: 293-373
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.44e-21
Family Aminomethyltransferase beta-barrel domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011821999.1.50451
Sequence length 378
Comment glycine cleavage system protein T [Hyperthermus butylicus]; AA=GCF_000015145.1; RF=representative genome; TAX=415426; STAX=54248; NAME=Hyperthermus butylicus DSM 5456; strain=DSM 5456; AL=Complete Genome; RT=Major
Sequence
MTGVKVPLYDVHRELGASLGEFAGWLVPIDYGSIVEEHVAVRKTVGFFDLSHMARIIVSG
PDAGKLLDKLVPRYLESEPGTMLGPTAFLNENAGFVDDVMLYNLGGNQWMIVANAVNREK
VLGWLNDWLSRLGFTASVEDKTLELAMFAVQGPKAAELMERLGAPREVLELKLLRFRLNV
ELSEAKARAFLVSRSGWTGEDGFEIIAPVGEAEKILRKAAEIVRELGGRLCGLGARDSLR
MEMGFVLYGHEIDEETTPVDARYWWVYQPGPKEDCVGCKALREALRRGAVKVRVGIRLSK
KARIVPRQGDKIYVEGVEVGHVTSGAYSPVLGRSIAQAYIKPSHALMGLTVEVERRGKRY
QGKIVDFPLVKPTSSPPL
Download sequence
Identical sequences A2BL20
415426.Hbut_0829 WP_011821999.1.50451 gi|124027706|ref|YP_001013026.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]