SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011834105.1.86236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011834105.1.86236
Domain Number 1 Region: 1-220
Classification Level Classification E-value
Superfamily NIF3 (NGG1p interacting factor 3)-like 2.88e-37
Family NIF3 (NGG1p interacting factor 3)-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011834105.1.86236
Sequence length 243
Comment hypothetical protein [Methanocorpusculum labreanum]; AA=GCF_000015765.1; RF=representative genome; TAX=410358; STAX=83984; NAME=Methanocorpusculum labreanum Z; strain=Z; AL=Complete Genome; RT=Major
Sequence
MIVADLIAQIETSVPPIYSMVGDEPQFFGSSQTLQTDISKVTVMMDYYSGQIIPEDTEFL
VLHHPPKTGIPPLPTYVLHSGWDAFPGGAGDALADVFELTERALLDASTRLGRVGKLPNG
AVSLDEFAKQAAKKLGRPYLQIVSEIPDISIETVAVVSGFGLNPSMIKLAKQKGADVFLS
GDLTHPGAILAKSLTIPLIDATHYATELPGLYRLRDLIASFGVESAVFDTSVPWRMKTYY
ENY
Download sequence
Identical sequences A2SU96
410358.Mlab_1741 gi|124486553|ref|YP_001031169.1| WP_011834105.1.86236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]