SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011838944.1.69113 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011838944.1.69113
Domain Number 1 Region: 5-158
Classification Level Classification E-value
Superfamily Nqo5-like 4.45e-36
Family Nqo5-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011838944.1.69113
Sequence length 184
Comment NADH dehydrogenase [Staphylothermus marinus]; AA=GCF_000015945.1; RF=na; TAX=399550; STAX=2280; NAME=Staphylothermus marinus F1; strain=F1; AL=Complete Genome; RT=Major
Sequence
MEIDKELIEKLPDKYKNSFSIEGTDTGKRIEITIEPQDLCKVLPAIKDAGYDHFIGITVI
DYPDENVFELVYLIDSISKNGQLVAIRTKLPRDNPVIDTASFIYPLAYYQEIEAYEFFGV
RFNNHDGLRKWILEDNWQGPPPFRKDIDTRDIVLKLYYGGKRYERPVQKRSLGGYSLMEK
GGEK
Download sequence
Identical sequences A3DM93
399550.Smar_0647 gi|126465552|ref|YP_001040661.1| WP_011838944.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]