SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011839767.1.69113 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011839767.1.69113
Domain Number - Region: 69-130
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00331
Family Galactokinase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011839767.1.69113
Sequence length 139
Comment hypothetical protein [Staphylothermus marinus]; AA=GCF_000015945.1; RF=na; TAX=399550; STAX=2280; NAME=Staphylothermus marinus F1; strain=F1; AL=Complete Genome; RT=Major
Sequence
MSELLDLAKRMVKAFRTFECFVFEKEEIDKVRELLVQADIRSLVRIRKADPRYPYIYVVV
PWSREFENICVSRVKKMLAEGRIDRETYNKRYNEMITQCIRHYERERVKEIIEKLERYIG
KGSGGGFGGKTTIFPLEFP
Download sequence
Identical sequences A3DPL3
WP_011839767.1.69113 gi|126466372|ref|YP_001041481.1| 399550.Smar_1484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]