SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011844020.1.74427 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011844020.1.74427
Domain Number - Region: 132-206
Classification Level Classification E-value
Superfamily SIS domain 0.0623
Family mono-SIS domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011844020.1.74427
Sequence length 222
Comment MULTISPECIES: membrane protein [Methanoculleus]; AA=GCF_000015825.1; RF=representative genome; TAX=368407; STAX=2198; NAME=Methanoculleus marisnigri JR1; strain=JR1; AL=Complete Genome; RT=Major
Sequence
MFDLPTANIGGPDLFVLEFGDIVAYFSPYTAALFVFALIFTVLVIVSRPERQVDIAFGGD
AYYTKVVDPDLLRFQRFMAIACGLATLGAVVTGDVFNFTLFASMVGITNIGIVAAYRNRH
VLNAAFQYGIVAMLATVPLFGGAAIVLAGTGTLSMWELFGGAMAVPLIAKAFLVLGVMGE
GMAPFYIAKAEITRAQGAPFILMVHVSSLLLFLRVTEIVISM
Download sequence
Identical sequences A0A063ZDZ4 A3CUQ9
WP_011844020.1.69318 WP_011844020.1.74427 368407.Memar_1178 gi|126179126|ref|YP_001047091.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]