SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011846545.1.86146 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011846545.1.86146
Domain Number 1 Region: 36-83,285-533
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.6e-67
Family Bacterial dinuclear zinc exopeptidases 0.031
Further Details:      
 
Domain Number 2 Region: 133-216
Classification Level Classification E-value
Superfamily PA domain 0.0000000785
Family PA domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011846545.1.86146
Sequence length 558
Comment peptidase M28 [Shewanella baltica]; AA=GCF_000015845.1; RF=na; TAX=325240; STAX=62322; NAME=Shewanella baltica OS155; strain=OS155; AL=Complete Genome; RT=Major
Sequence
MRRLYPLCALAMLSACSPNASEPDGNSTLAELKPVQFNEARFRNDIKALSSDEFEGRAPT
THGEKLTLDYLTKAFTEMGLKGAYQGSFLQPVPMVSYTADEAQQVTLAGLPFKYRKDLVL
SSRHDNGGINIENAPLVFVGYGVNAPEYGWNDYQDLDMKGKIAVILVNDPGFARPDSGKF
NGKAMTYYGRWSYKFEEASRQGALGALIIHDTEPASYPWSVVENSWTGPQQDLVLSKAEQ
DSRIQVEGWLTLDAATQLFDKSGLSLPSLMARAADSPINVPLEQTASIAFKNKAEYANSY
NVVATLPGSTQADKQILYTAHWDHIGKDETKAGDQIYNGAMDNASGTAGILEIARQLADN
AKQGHGLARSVTFIATTGEEQGLLGSRYYAANPLYPIDKTVAVLNLDSTNIYGKTKNFTI
VGKGKSELETYLIDAAKQQNRIAMGEKNPASGGFFRSDHFSFAKLGVPAVFAGGGSDPVD
EATAAYKTQMQATMKGCYHNVCDEYHEDWDLSGALQDLQIYYQVTRTLGNSKDWPGYYQG
TEFNSLRPAKTTLMTDAK
Download sequence
Identical sequences A3D3C8
325240.Sbal_1732 gi|126173961|ref|YP_001050110.1| gi|386340721|ref|YP_006037087.1| WP_011846545.1.8014 WP_011846545.1.86146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]