SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011847226.1.8014 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011847226.1.8014
Domain Number 1 Region: 187-246,291-457,602-720
Classification Level Classification E-value
Superfamily Subtilisin-like 2.49e-63
Family Subtilases 0.0027
Further Details:      
 
Domain Number 2 Region: 446-582
Classification Level Classification E-value
Superfamily PA domain 0.00000000000405
Family PA domain 0.008
Further Details:      
 
Weak hits

Sequence:  WP_011847226.1.8014
Domain Number - Region: 129-181
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0156
Family Subtilase propeptides/inhibitors 0.0073
Further Details:      
 
Domain Number - Region: 1186-1270
Classification Level Classification E-value
Superfamily Cadherin-like 0.0785
Family Cadherin 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011847226.1.8014
Sequence length 1298
Comment protease [Shewanella baltica]; AA=GCF_000215895.1; RF=na; TAX=693970; STAX=62322; NAME=Shewanella baltica OS117; strain=OS117; AL=Complete Genome; RT=Major
Sequence
MKTKIALAVSMALLSSSANAQTVLSPTGETLQLDIPSELQATSLRGNAAGAEVKFVPEAD
LGEGEFTYIVRLRDSSVANYQGTTLGFKATSSQRVQTSGTSKVAVNGKLDASRPEVKSYV
SYLKVKQNRFLANASAAIGTNLQPLTTYQYALNGMAVRMTQAQAKKMAELPEVAFVERER
MEQMETDVSQALIGSPNVWDGSATGTKAMGEGVIVGIIDSGINSDHASFADVGQDGYDHT
NPLGQGIYIGDCKTDFASMCNDKLIGVRSYPEITNNFDDVKVYGDTPPAKNGEDYGGHGS
HVASTAAGNILVNVPYVQGETGKLEGDGIATGLEFAQISGVAPHANIIAYQICNPGNAGD
TYSGCPTAPILKALDDAIKDGVDVINFSISGGGNPWNSATEQGFLAARNAGIFAAVAAGN
TRAATNTSPAINQTPYSTPKNAPWYTSVANSTHNRDIVRAVEFNGKNYHYTAGSGPVQTE
VLKGLPVYAGTIDAANFEACKPFAADAFKDKIAVLRRGGCSFDIKVAAAMKAGAKGVIVF
NRDGENNARLTMSGLDKLDIPAVFIGDIDGLELIAAMAANPALEITLSPTPKVISKEADV
LAASSLIGPNLTNDVLVPYVAAPGSDIYAAYSDQQFGHDKAGTDPADFTLMSGTSMASPH
VAGAGALLKSLHKDWTPDNIRSALMMTATTAQAMKKADGKTVADPFDVGAGRIRVDLAAK
SGLVMDESALNYEIANPTTGGDPRKLNIPSMADSRCIDTCTWTRTVTATADGSWTAKGVS
ATDKFALTVTPESFNLKKGESQTITVAADVTDVGASWGFGNLVLASEAFPTANMPIVAKI
AKRDLPTVVPVSASRDADERNLAHLKAIDLPGVAATVTALKLSDTYESSVKQDSNTDSAF
DDLADGVKVFSFNVEDKALYFNASIGNTTSPDLDMFVILDKKDGSKLSIAASSAFGGSKE
SVSIKDPVKGEYIVVIQNYQASAADADDAFSLKQVTLYDEAGDNLTANLTGDHKDFNVNL
AWKQAMLVGDAGLAMLTLTTTDDKVAPVKIPVIFERVSDDVLPPLGSTVSGELTPGAAKV
MKTRVEANKTQETRVYTLEALLPEGHEVANISHQGTQVGNKITWTIEMASGAAAQDVTFD
LVPRKASQDNLVTLTNKVNNESAEILKQEYQFDVPEVAPVAVIEAPVSVQEGKPLFIDAS
KSSDANNDPLTYKWTQLGGASFNFDANAAKLNLVAPEVSGTAQTVSFQLTVADNHGNKDS
SVVSVSVTETPAKKDDGGSLGWLSLLLLPFAFGRRKQG
Download sequence
Identical sequences A3D6D8
gi|126175021|ref|YP_001051170.1| 325240.Sbal_2816 gi|386341775|ref|YP_006038141.1| WP_011847226.1.8014 WP_011847226.1.86146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]