SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011854598.1.44017 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011854598.1.44017
Domain Number 1 Region: 351-710
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 5.36e-34
Family Soluble quinoprotein glucose dehydrogenase 0.00027
Further Details:      
 
Domain Number 2 Region: 712-802
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000876
Family PKD domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011854598.1.44017
Sequence length 999
Comment hypothetical protein [Mycobacterium sp. JLS]; AA=GCF_000016005.1; RF=na; TAX=164757; STAX=164757; NAME=Mycobacterium sp. JLS; strain=JLS; AL=Complete Genome; RT=Major
Sequence
MTANDRKVTSTYARYIGRVGALALALGVGGAVATTPGVARAEDSPSSVTDSTGVSSPSGG
EQARTTTGDDTTPDDDQSEIVDDGDAEDPAESEDAEESEDLAEDEDPDEGEDLDEPDGIG
DPLEPAQPPAEPVEEPDVPAEPAVETPVDTGTPAQETGGPAGDDAGQAADPADATVIDDA
PAPDPDAAVPDVDAASDESTSSRSYQTLSLTESDDSALVTSARTKLTGLPPLRLNLPTPE
EFIASIPAPVVTCLCGVINTVTKFFDNVLKPMLGGGAGAAGPGPAAPGSSPALWAVAAWV
RRQATQAIDGFLASPLATPIRMSERAVFDFGGSPQGRALSAAVVQFIGQCGPSADLPAEL
DRTVVVSGLTEPTDFKILNKHDKDEVDRIFIAEKGGSVKVYNPETRTVTTLTVISTTTGG
ERGLTGIEVHPDFWHEDEFGYRSIYVAYTAGDTNRDTLARLILSDDMTRVERSEILIEST
ENANTFHHGGDLSFDNEGQHLYWVVGDNTQGVVNSQSLSNIHGKVLRLNADGSVPEDNPF
VDDDPDTASPADYIYAYGFRNPFRLTFTPDGKLLVADVGESKWEELNLVVKGGNYGWPQA
EGSCTGCASINPIYVYEHSAPPVSGGAITSVTVFDGAGFPEEYRNRVFIADYSLGWIRVL
DFDEQYTSLISAKTFWGNAGATVNLAQGPDDNLYQLTIYPGELSMISPSGGNRAPTAVID
ASQTTTADKTLVVNFSGLRSYDPDDDDTLTYRWDFGDGSSSTEATPVNEFKATGSYSTYT
VTLTVSDGEKTNTTTQKITVGSTPPVAEIVSIPSSYDAGDTITFTGRGTDAQDRPDGTPL
PGTAYKWTVVFHHNEHTHPFADNLVGETATITIPRSRDQIDGTFYRVHLTVTDSSGLSRT
TYKDVNPNLVELTIAASDPGARFSIDGLPYTGSYTERAVVGVDYVISAPTTQTVNGRQLT
FDGWSDGGAATHTIRVPEQATTYTATYTASSGANLAQVV
Download sequence
Identical sequences WP_011854598.1.44017 164757.Mjls_0775 gi|126433385|ref|YP_001069076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]