SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011864328.1.33760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011864328.1.33760
Domain Number 1 Region: 22-294
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.43e-93
Family Methylenetetrahydrofolate reductase 0.00000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011864328.1.33760
Sequence length 296
Comment 5,10-methylenetetrahydrofolate reductase [Shewanella loihica]; AA=GCF_000016065.1; RF=representative genome; TAX=323850; STAX=359303; NAME=Shewanella loihica PV-4; strain=PV-4; AL=Complete Genome; RT=Major
Sequence
MAFHHAQHANSLNQSLSELNGDINVSFEFFPPATPEMETILWNSIRRLEPLKPKFVSVTY
GANSGVRDRTHGVIERIQKETDLVAAPHLTLVDASDEELVELAKHYWNSGIRDIVALRGD
LPAGSPKPTRFANDLVRLLKSVADFDISVAAYPEVHPDAPNAQADLINLKKKIDAGANRA
ITQFFFDVESYLRFRDRCVAAGIDVEIVPGILPVTNFTQLKRFAGMTNVSIPSWLHKQFE
GLDDDPSTRQMVGANVAIDMVKVLSREGVKDFHFYTLNRAELTYAICHTLGVRPGK
Download sequence
Identical sequences A3QA96
323850.Shew_0522 gi|127511456|ref|YP_001092653.1| WP_011864328.1.33760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]