SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011868031.1.72418 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011868031.1.72418
Domain Number 1 Region: 2-198
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-40
Family GHMP Kinase, N-terminal domain 0.0000079
Further Details:      
 
Domain Number 2 Region: 191-313
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.4e-24
Family Mevalonate kinase 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011868031.1.72418
Sequence length 317
Comment mevalonate kinase [Methanococcus maripaludis]; AA=GCF_000016125.1; RF=na; TAX=402880; STAX=39152; NAME=Methanococcus maripaludis C5; strain=C5; AL=Complete Genome; RT=Major
Sequence
MKKIKTPSKIILFGEHAVVDGYPAISMALDLKTTGEIEENSDTISIDLVDLNEIFEITPE
LIKNLEISNFSPALKYVICAVKSVIFYLSEFKDLKEIKPFKLKLYSEIPLSCGLGSSASV
VVTVIRSISNFYGIELDNDETINLAYSVEKEVQGRASVTDTATISLGGMIEIINGEYKPM
PKDLEEFIKTCKFLVVNVEERTRKTAELVHDVSKHPEKEQIFEEIGNIIQKVRQVTEKAE
LGKLMNENHELLRKFGISTEKLDLVAKAGQKYGYGGKLTGAGGGGSAIILLKEDQNELLN
ELKKIGVIGIYECKMAN
Download sequence
Identical sequences A4FWJ9
gi|134045303|ref|YP_001096789.1| WP_011868031.1.72418 402880.MmarC5_0258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]