SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011880402.1.85937 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011880402.1.85937
Domain Number 1 Region: 446-557
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011880402.1.85937
Sequence length 585
Comment transporter [Burkholderia vietnamiensis]; AA=GCF_001528495.1; RF=na; TAX=60552; STAX=60552; NAME=Burkholderia vietnamiensis; strain=AU15829; AL=Contig; RT=Major
Sequence
MNRPWSARVARMLPGIALLTHYQRAWLSRDLYAGLALSAVLLPVGMSYAQAAGLPAITGL
YASIAALLAYALFGPSRILVLGPDSALAALIASAITPLAAHDPQRAIALAGALALSAGTI
CILLGALGLGFVTDLLSRPIQYGYLNGIAIALAIGRLPELLGMQTSGGDVFAGVQHIAHA
LVDGRFSVAAGLLGAGVLAAIFLMKRALPRWPGVLLAVIGATIATRLWPLPGVATIGALP
AGIPAPRLPAVSLADLGALASGAFAVALVSFADISMLSRALSARAGDTPDRNQELIALGA
ANLLTGVTQGCAVSSSASRTPVAIAAGAQSQLTNVVAAACIAILLLAAPTLLAYVPRTAL
AAVVIYAACGIADFRSVVRLYRMRRGECLISVLCFAGVIAIGVVPGILLASGLSLLSFVW
RAWHPYDAVLGRLTGVRGYHDVGRHPDAAQTPGLVLFRWDAPLFYANVEIFCEHLHAAIT
RSASPVTRIVVAAEPVTDIDVSAADRLVALHAELAEQRIELDFAEMKGPVKDRLRAYGLF
DVFGAASFFPTVTDAVARHVQRTEGHARACKKKRAMRKRAARKAR
Download sequence
Identical sequences A0A124PMU2 A4JSJ1
269482.Bcep1808_6344 gi|134291730|ref|YP_001115499.1| WP_011880402.1.100586 WP_011880402.1.16060 WP_011880402.1.29019 WP_011880402.1.42332 WP_011880402.1.44217 WP_011880402.1.57845 WP_011880402.1.75555 WP_011880402.1.82398 WP_011880402.1.85937 WP_011880402.1.91243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]