SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011882823.1.58797 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011882823.1.58797
Domain Number 1 Region: 642-1098
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-126
Family ALDH-like 0.000000267
Further Details:      
 
Domain Number 2 Region: 258-607
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.35e-120
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000000564
Further Details:      
 
Domain Number 3 Region: 88-257
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 6.41e-65
Family N-terminal domain of bifunctional PutA protein 0.000000413
Further Details:      
 
Domain Number 4 Region: 4-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000511
Family PutA pre-N-terminal region-like 0.00095
Further Details:      
 
Weak hits

Sequence:  WP_011882823.1.58797
Domain Number - Region: 1133-1292
Classification Level Classification E-value
Superfamily ALDH-like 0.00055
Family ALDH-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011882823.1.58797
Sequence length 1309
Comment MULTISPECIES: trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase [Burkholderia]; AA=GCF_001528565.1; RF=na; TAX=60552; STAX=60552; NAME=Burkholderia vietnamiensis; strain=AU26564; AL=Contig; RT=Major
Sequence
MASTTLGVKVDDLLRSRLKDAATRLERTPHWLIKQAIFAYLERIEHGQLPPELSGSSGVT
ELADGHAAEDDDNSPHPFLEFAQNVQPQSVLRAAITAAYRRPEPECVPFLLGQARLPANL
QADVQTLATHLVETLREKSSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDAL
IRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRLIGRGGEPLI
RKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDALRYYASY
EQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQDRTMSELLPRVRALALLARRYD
IGLNIDAEEADRLELSLDLLEALCFDPDLAGWNGIGFVVQGYQKRCPFVIDYLIDLARRS
RHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLAAPDAVYPQF
ATHNAYTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTHE
TLLAYLVRRLLENGANTSFVNRIADKTVSVKELVADPVDEASKVVPLGAPHAKIPLPRNL
YGDERANSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLADDALADAPARDVRNPADQR
DVVGAVSEATSEHVSAALAHAVAAAPIWQATPVDARADCLVRAADLLEAQMHTLMGLIVR
EAGKSLPNAIAEIREAVDFLRYYAAQIRGEFSNDTHRPLGPVVCISPWNFPLAIFMGQVA
AALAAGNTVLAKPAEQTPLIAAQAVRLLREAGVPAGAVQLLPGTGETVGAALVADPRTRA
VMFTGSTEVARLINKTLSARLDPDGKPIPLIAETGGQNAMIVDSSALAEQVVADVMQSSF
DSAGQRCSALRVLCLQDDVADRTLTMLKGAMHELALGNPDRLSTDVGPVIDAEAKQTIDT
HVAAMKDKGHAVTQLPMPDACAHGTFVPPTLIEIGSIDELKREVFGPVLHVVRYRRSQLD
KLLEQIRATGYGLTLGIHTRIDETIAHVIANAHVGNIYVNRNVIGAVVGVQPFGGEGLSG
TGPKAGGALYLQRLLATRPSGLPKALAQTLIADGVAEGEQRGNPAAALTALRDWLIEQRE
PALAARCDGYLSQVPAGATAVLTGPTGERNTYTLGPRGTVLCVAATPSGARAQFAAVLAT
GNRALFAGSAGEALVAALPAALKGHAAVRKQADAPFDAVLFEGDSDELQTLVKDVAQRPG
PIVSVQGVSAGAFENGDAEDYALERLLTERSVSVNTAAAGGNANLMTIG
Download sequence
Identical sequences A0A124P635 A4JA42 I2DIK4
gi|134294245|ref|YP_001117980.1| 269482.Bcep1808_0122 WP_011882823.1.100533 WP_011882823.1.100586 WP_011882823.1.11466 WP_011882823.1.15885 WP_011882823.1.16060 WP_011882823.1.17582 WP_011882823.1.1808 WP_011882823.1.20738 WP_011882823.1.22835 WP_011882823.1.23278 WP_011882823.1.242 WP_011882823.1.24430 WP_011882823.1.24445 WP_011882823.1.29019 WP_011882823.1.34430 WP_011882823.1.35901 WP_011882823.1.40662 WP_011882823.1.42332 WP_011882823.1.44217 WP_011882823.1.4627 WP_011882823.1.48957 WP_011882823.1.56091 WP_011882823.1.57845 WP_011882823.1.58403 WP_011882823.1.58797 WP_011882823.1.59706 WP_011882823.1.60365 WP_011882823.1.61106 WP_011882823.1.62776 WP_011882823.1.66494 WP_011882823.1.68849 WP_011882823.1.72014 WP_011882823.1.74552 WP_011882823.1.75555 WP_011882823.1.81796 WP_011882823.1.82398 WP_011882823.1.82744 WP_011882823.1.85080 WP_011882823.1.85937 WP_011882823.1.86522 WP_011882823.1.86980 WP_011882823.1.91243 WP_011882823.1.95492 gi|387900872|ref|YP_006331211.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]