SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011903403.1.63010 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011903403.1.63010
Domain Number - Region: 53-132
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0305
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011903403.1.63010
Sequence length 139
Comment hypothetical protein [Polynucleobacter asymbioticus]; AA=GCF_001870325.1; RF=na; TAX=576611; STAX=576611; NAME=Polynucleobacter asymbioticus; strain=MWH-Recht1; AL=Contig; RT=Major
Sequence
MKNHSLGKMPTWQRLFTISVFCICSISGISFLLGHEFQISRATLGNRNILIIHGVSAAIT
LIAFGAILPFHIKAGLKAKKNLISGVFQLILLLVLVITAMLLYYGPEELHEGSELIHWIL
GLTFFGIFIYHAINRALRK
Download sequence
Identical sequences A4SZ66
gi|145589747|ref|YP_001156344.1| WP_011903403.1.22821 WP_011903403.1.27397 WP_011903403.1.31131 WP_011903403.1.54276 WP_011903403.1.58031 WP_011903403.1.63010 WP_011903403.1.78143 312153.Pnuc_1566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]