SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011907066.1.96002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011907066.1.96002
Domain Number 1 Region: 120-376
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.7e-61
Family D-glucarate dehydratase-like 0.000000442
Further Details:      
 
Domain Number 2 Region: 9-133
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.92e-34
Family Enolase N-terminal domain-like 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011907066.1.96002
Sequence length 387
Comment muconate cycloisomerase [Novosphingobium aromaticivorans]; AA=GCF_000013325.1; RF=representative genome; TAX=279238; STAX=48935; NAME=Novosphingobium aromaticivorans DSM 12444; strain=DSM 12444; AL=Complete Genome; RT=Major
Sequence
MTALANPQILGIETILLDLPTIRPHVLAMATMHAQTICLVRLTCSDGIVGLGEATTIGGL
AYGPEAPETIKTAIDTYFAPLLAGQDATRPAAAMALVARHVVGNHFAKCAIETALLDAQG
KRLGLPVSELLGGRRVDSLPVLWTLASGDTARDIAEAEQMLDTRRHDAFKLKIGKRPIEQ
DVAHVGAIKAALGDRASVRVDVNMAWDEPTARRGLAMLADAGCDLVEQPIIRHNRDGMAR
LVALGLVPVMADESLTGPASAMDFARAAAADVFAVKIEQSGGLDAARAVAQIGDAACIGL
YGGTMLEGAIGTIASAHAFATFPALKWGTELFGPLLLTEEILERPLTYADFSLEVPAGPG
LGIALDEDRVEHFRRDRTATQFALQGA
Download sequence
Identical sequences A4XFH6
gi|146276053|ref|YP_001166213.1|NC_009427 279238.Saro_3828 NYSGXRC-9450c gi|146276053|ref|YP_001166213.1| WP_011907066.1.26809 WP_011907066.1.96002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]