SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011912820.1.82288 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011912820.1.82288
Domain Number 1 Region: 7-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011912820.1.82288
Sequence length 160
Comment anti-anti-sigma factor [Pseudomonas stutzeri]; AA=GCF_002193135.1; RF=na; TAX=316; STAX=316; NAME=Pseudomonas stutzeri; strain=19; AL=Contig; RT=Major
Sequence
MSTGRIQFAEMDGTFVLKFIGEIRLTLCSALDATIEKIFSSLNFSSIVIDLTESRSIDST
TLGLLAKLSILSRQKVGMLPTLVTTHPDITRLLQSMGFDQVFNIVDTPLPCPECLADLPS
QDQSEDVVKAKVLEAHRILMSLNESNREAFHDLVTALERS
Download sequence
Identical sequences A0A0H3YWB7 A0A0T8LGN6 A0A1G3DP84 A4VK42 F2N065 S6JJP3
379731.PST_1659 gi|339493646|ref|YP_004713939.1| gi|386020308|ref|YP_005938332.1| gi|146282032|ref|YP_001172185.1| WP_011912820.1.11668 WP_011912820.1.31855 WP_011912820.1.43901 WP_011912820.1.45895 WP_011912820.1.54801 WP_011912820.1.55002 WP_011912820.1.62806 WP_011912820.1.6831 WP_011912820.1.7470 WP_011912820.1.82288 WP_011912820.1.85630 WP_011912820.1.88125 WP_011912820.1.90639 WP_011912820.1.9384 WP_011912820.1.98540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]