SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011915698.1.70764 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011915698.1.70764
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 4.58e-25
Family TTHA1013-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011915698.1.70764
Sequence length 138
Comment MULTISPECIES: HicB family protein [Caldicellulosiruptor]; AA=GCF_000404025.1; RF=na; TAX=1214564; STAX=1214564; NAME=Caldicellulosiruptor sp. F32; strain=F32; AL=Contig; RT=Major
Sequence
MADKYIFPAVFEPGENGGYCVTFPDLPGCITEGETLEEALYMAKEALELHLYGLEEDNEE
IPEPTPPEKLDIPRGAFVVPIIVYMPPVREEMANKSVNKTVTLPRWLNKAAEEAHINFSQ
VLQEALKVKLGIKERLQA
Download sequence
Identical sequences A4XFQ0
WP_011915698.1.70764 WP_011915698.1.85531 gi|146295155|ref|YP_001178926.1| 351627.Csac_0081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]