SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011915698.1.85531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011915698.1.85531
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 4.58e-25
Family TTHA1013-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011915698.1.85531
Sequence length 138
Comment MULTISPECIES: HicB family protein [Caldicellulosiruptor]; AA=GCF_000016545.1; RF=representative genome; TAX=351627; STAX=44001; NAME=Caldicellulosiruptor saccharolyticus DSM 8903; strain=DSM 8903; AL=Complete Genome; RT=Major
Sequence
MADKYIFPAVFEPGENGGYCVTFPDLPGCITEGETLEEALYMAKEALELHLYGLEEDNEE
IPEPTPPEKLDIPRGAFVVPIIVYMPPVREEMANKSVNKTVTLPRWLNKAAEEAHINFSQ
VLQEALKVKLGIKERLQA
Download sequence
Identical sequences A4XFQ0
351627.Csac_0081 WP_011915698.1.70764 WP_011915698.1.85531 gi|146295155|ref|YP_001178926.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]