SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011917135.1.85531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011917135.1.85531
Domain Number 1 Region: 4-156
Classification Level Classification E-value
Superfamily RNase III domain-like 2.27e-48
Family RNase III catalytic domain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 108-223
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 9.43e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011917135.1.85531
Sequence length 224
Comment ribonuclease III [Caldicellulosiruptor saccharolyticus]; AA=GCF_000016545.1; RF=representative genome; TAX=351627; STAX=44001; NAME=Caldicellulosiruptor saccharolyticus DSM 8903; strain=DSM 8903; AL=Complete Genome; RT=Major
Sequence
MTDIEKKLGYRFKNPNLLKLALTHKSATHDDKSCYERLEFLGDAVLELVVSKYLFEHFPQ
LSEGELTNLRATIVCSETLSKVAETLNLKRYIVFGKNEKKEGFEGNKSIWSDVLEAIFGG
IFLESGFDMAEKIVINLLEPFIKKAAEGKLFYDYKTKLQEFIQREKNVKIKYIDYENFED
NLSRFKSELYIGKNKISEGYGNSKKEAQQEAALNALKKLGVIED
Download sequence
Identical sequences A4XJW5
gi|146296620|ref|YP_001180391.1| 351627.Csac_1608 WP_011917135.1.85531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]