SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011921293.1.27320 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011921293.1.27320
Domain Number 1 Region: 91-166
Classification Level Classification E-value
Superfamily Single hybrid motif 3.14e-21
Family Biotinyl/lipoyl-carrier proteins and domains 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011921293.1.27320
Sequence length 167
Comment acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [Metallosphaera sedula]; AA=GCF_001266655.1; RF=na; TAX=43687; STAX=43687; NAME=Metallosphaera sedula; strain=ARS50-1; AL=Complete Genome; RT=Major
Sequence
MKLYRVHADTGDTFIVAHDQKENKDRLKTENNEFEIEYVGQGTREGEIILKINGEMHRVF
IDNGWIILDNARIFRAERVTELPTQEGQTLDEMIKGKEGEVLSPLQGRVVQVRVKEGDAV
NKGQPLLSIEAMKSETIVSAPISGLVEKVLVKAGQGVKKGDILVVIK
Download sequence
Identical sequences A4YD23 Q8J2Z3
WP_011921293.1.15515 WP_011921293.1.27320 WP_011921293.1.28583 WP_011921293.1.31166 WP_011921293.1.34633 WP_011921293.1.8883 WP_011921293.1.99084 399549.Msed_0148 gi|146302933|ref|YP_001190249.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]