SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011929081.1.67918 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011929081.1.67918
Domain Number 1 Region: 28-91
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000115
Family NfeD domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011929081.1.67918
Sequence length 96
Comment serine protease [Dehalococcoides mccartyi]; AA=GCF_002024205.1; RF=na; TAX=61435; STAX=61435; NAME=Dehalococcoides mccartyi; strain=KBVC2; AL=Complete Genome; RT=Major
Sequence
MSWYWIASLIVIVVLIIIFVVNQVVSAHLKQAATGKEELYGKKALVKTPLNPEGKVLYDG
EIWAAHIENGSAEVGQEVVIVRLEGLKLYVKMERSE
Download sequence
Identical sequences A0A142V9P5
216389.DehaBAV1_0766 gi|452205071|ref|YP_007485200.1| WP_011929081.1.45256 WP_011929081.1.52557 WP_011929081.1.5855 WP_011929081.1.62194 WP_011929081.1.67918 WP_011929081.1.83924 WP_011929081.1.84634 WP_011929081.1.89941 WP_011929081.1.91135 WP_011929081.1.92458 gi|147669409|ref|YP_001214227.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]