SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011949791.1.24405 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011949791.1.24405
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily PTS system IIB component-like 0.0000000000000419
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011949791.1.24405
Sequence length 94
Comment PTS sucrose transporter subunit IIABC [Mycoplasma agalactiae]; AA=GCF_000089865.1; RF=na; TAX=2110; STAX=2110; NAME=Mycoplasma agalactiae; strain=5632; AL=Complete Genome; RT=Major
Sequence
MKVLCLCGSGMGTSMIIKLKTEQAMRELGIQGSVEALGLGMGKSVANNFDVILCTNNFVS
EVANSKASVHGLKNVMDINEIKAAFKDALAKGIK
Download sequence
Identical sequences A5IZ78 D3VRI9
gi|291320625|ref|YP_003515890.1| 347257.MAG_6370 gi|148377900|ref|YP_001256776.1| WP_011949791.1.24405 WP_011949791.1.3023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]