SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011953329.1.48025 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011953329.1.48025
Domain Number 1 Region: 4-213
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 8.63e-53
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.00000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011953329.1.48025
Sequence length 218
Comment formate dehydrogenase subunit gamma [Pseudomonas putida]; AA=GCF_000287915.1; RF=na; TAX=1215087; STAX=303; NAME=Pseudomonas putida S12; strain=S12; AL=Contig; RT=Major
Sequence
MNDNKPILRYNANERSNHWVVAILFILAGLSGLALFHPALFWLSNLFGGGPWTRILHPFI
GVAMFVFFLGLVLRFWRANFITANDRLWLRRVDRVMRNEEEGVPPIGKYNAGQKLLFWTL
LVCMLVLLVSGVVIWRAYFSHWFGIDAIRLSALLHALAAFVLILSIIVHIYAGIWIKGSI
GAMLHGWVSRAWARKHHELWYREVTGDKTPGDHGRKEG
Download sequence
Identical sequences A0A0A7PSW3 A0A179R4M4 A0A2K4LLU8 A5VXT5 I3UWZ3
351746.Pput_0525 gi|395446876|ref|YP_006387129.1| WP_011953329.1.100978 WP_011953329.1.1079 WP_011953329.1.31851 WP_011953329.1.34900 WP_011953329.1.35996 WP_011953329.1.41 WP_011953329.1.42045 WP_011953329.1.47320 WP_011953329.1.48025 WP_011953329.1.62773 WP_011953329.1.675 WP_011953329.1.74642 WP_011953329.1.96951 gi|148545777|ref|YP_001265879.1| gi|386010151|ref|YP_005928428.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]