SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011956887.1.23570 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011956887.1.23570
Domain Number 1 Region: 148-243
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.83e-23
Family Anti-sigma factor antagonist SpoIIaa 0.0026
Further Details:      
 
Domain Number 2 Region: 31-129
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000143
Family Histidine kinase 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011956887.1.23570
Sequence length 250
Comment anti-sigma factor antagonist [Roseiflexus sp. RS-1]; AA=GCF_000016665.1; RF=na; TAX=357808; STAX=357808; NAME=Roseiflexus sp. RS-1; strain=RS-1; AL=Complete Genome; RT=Major
Sequence
MPMKSLTVPATLESLAQISAFVNEASQCAGLDDHTAWQVELAVDEAATNIIQHGYAPDHP
GIIELTWRIEDGRLVITLRDYGRRFNPDDVPPPDVSSPLEERQPGGLGLYLMNRLMDQVR
FDFDDTNGNLLTMVKYIIQPRVSVEVREFCLSGRLDAVGAASALAPVHQAIADGAAYVLI
DFGNVTFLSSTALRSLLLARKDLLERNGELRLCNLRPQVREVFELTGFTQVFAIHSSRAE
ALAAFGQEHV
Download sequence
Identical sequences A5UV88
357808.RoseRS_2161 WP_011956887.1.23570 gi|148656286|ref|YP_001276491.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]