SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011963682.1.27491 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011963682.1.27491
Domain Number - Region: 13-73
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.034
Family Capz alpha-1 subunit 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011963682.1.27491
Sequence length 214
Comment hypothetical protein [Flavobacterium psychrophilum]; AA=GCF_900186685.1; RF=na; TAX=96345; STAX=96345; NAME=Flavobacterium psychrophilum; strain=LM-01-Fp; AL=Contig; RT=Major
Sequence
MNQITNFWNHFKQNNFVFLLLNEIPKNELKIHFDKLTTLLRQYNKDLDLIIKNKNKEAEI
IITANGNPYLFKEVELLVHHAPIVERWKTIAFLQPQTNISKYKQGIDKPIENYGISLRIS
EMYFEPLENPNNPNNLGVRIYTKNYIIHKDNPRLREVVYAHIEHLIGEKSFANNINFIEI
YQFHPSENIGFRFIELYNLGAYIEKFQGNNNIEL
Download sequence
Identical sequences A0A075RG81 A6GZW4
WP_011963682.1.100426 WP_011963682.1.10377 WP_011963682.1.15665 WP_011963682.1.16958 WP_011963682.1.22253 WP_011963682.1.27336 WP_011963682.1.27491 WP_011963682.1.30825 WP_011963682.1.31486 WP_011963682.1.32945 WP_011963682.1.33550 WP_011963682.1.3641 WP_011963682.1.40553 WP_011963682.1.40914 WP_011963682.1.43917 WP_011963682.1.45424 WP_011963682.1.50511 WP_011963682.1.53635 WP_011963682.1.61602 WP_011963682.1.68717 WP_011963682.1.73469 WP_011963682.1.75146 WP_011963682.1.76480 WP_011963682.1.76736 WP_011963682.1.8427 WP_011963682.1.87756 WP_011963682.1.90531 WP_011963682.1.91006 WP_011963682.1.94014 WP_011963682.1.94582 WP_011963682.1.94875 YP_001296446.1.27502 gi|150025620|ref|YP_001296446.1| 402612.FP1569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]