SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011969485.1.61285 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011969485.1.61285
Domain Number 1 Region: 5-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.73e-87
Family ABC transporter ATPase domain-like 0.000000688
Further Details:      
 
Domain Number 2 Region: 238-354
Classification Level Classification E-value
Superfamily MOP-like 0.000000000068
Family ABC-transporter additional domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011969485.1.61285
Sequence length 356
Comment polyamine ABC transporter ATP-binding protein [Sinorhizobium medicae]; AA=GCF_000419785.1; RF=na; TAX=1041150; STAX=110321; NAME=Sinorhizobium medicae WSM244; strain=WSM244; AL=Contig; RT=Major
Sequence
MQPVVQFENVNKYYGALPAVDGLNLAIEPGQFVTLLGPSGCGKSTTLRMLGGFEQPSSGE
IYLEGKAISHLPPNRRNVNIVFQDYALFPHLNVGRNIAFGLELKGLSSDAIHKRTMELLA
LVKLEDFAGRMPDQLSGGQRQRVALMRALAPDPNVLLLDEPLSALDAKLRQQMQIELKTI
QRTTGKTFIFVTHDQEEALTMSDVIVVMNKGRIEQMGDPNELYSRPRSRFVANFIGQSNF
LEGKALSVDGTVATIDWNGTAIRADVNGTQPAKDSPTTVALRPEALYCLAEQPQDRFALK
GRIVQRVFKGAHTALTVDLENGAQLHLQLDPVALSHIGTDEIWVGWRERDAVVLAD
Download sequence
Identical sequences A6UG82
gi|150375999|ref|YP_001312595.1| gi|150375999|ref|YP_001312595.1|NC_009620 WP_011969485.1.29075 WP_011969485.1.61285 WP_011969485.1.89664 YP_001312595.1.44884 366394.Smed_3850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]